| Desktop | 77/100 | ❗ |
| Mobile | 33/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 64 KB | ✔ |
| Compression | 13 KB (-79.9%) | ✔ |
| Text/Html Ratio | 1695 / 65538 (bytes) = 2.59% | ❗ |
| Load Time | 0.12 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 17 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-US | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 12 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| marketing | 9 | ✔ | ✔ | ✘ |
| shot | 6 | ✘ | ✘ | ✘ |
| business | 5 | ✘ | ✔ | ✘ |
| services | 4 | ✔ | ✔ | ✘ |
| tactical | 3 | ✘ | ✘ | ✘ |
| help | 3 | ✘ | ✔ | ✘ |
| about | 3 | ✘ | ✘ | ✘ |
| connect | 3 | ✘ | ✘ | ✘ |
| home | 2 | ✘ | ✘ | ✘ |
| small | 2 | ✘ | ✔ | ✘ |
| would | 2 | ✘ | ✘ | ✘ |
| assistance | 2 | ✘ | ✘ | ✘ |
| additionalstrategic | 2 | ✘ | ✘ | ✘ |
| having | 2 | ✘ | ✘ | ✘ |
| extend | 2 | ✘ | ✘ | ✘ |
|
With 0.12 seconds in page load, 64 KB of page size and all other reports below, the amplifiedmarketingservices.com has a SEO score of 66 out of 100 |
| Title | Amplified Marketing Services |
| Description | Amplified Marketing Services helps small businesses thrive by providing hands on marketing support to generate a buzz in the marketplace. |
| Keyword |
| Age | 9 Years, 8 Days |
| Created | 5th-Oct-2013 |
| Updated | 14th-Sep-2022 |
| Expiry | 5th-Oct-2023 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| amplifiedmarketingservices.com | A | 597 | ip:198.49.23.144 |
| amplifiedmarketingservices.com | A | 597 | ip:198.49.23.145 |
| amplifiedmarketingservices.com | A | 597 | ip:198.185.159.145 |
| amplifiedmarketingservices.com | A | 597 | ip:198.185.159.144 |
| amplifiedmarketingservices.com | NS | 3600 | target:ns65.domaincontrol.com |
| amplifiedmarketingservices.com | NS | 3600 | target:ns66.domaincontrol.com |
| amplifiedmarketingservices.com | SOA | 3600 | mname:ns65.domaincontrol.comrname:dns.jomax.netserial:2018082600refresh:28800retry:7200expire:604800minimum-ttl:600 |
| amplifiedmarketingservices.com | MX | 3600 | pri:0target:amplifiedmarketingservices-com.mail.protection.outlook.com |
| amplifiedmarketingservices.com | TXT | 3600 | txt:google-site-verification=Lpodj7RjU0F29GrDBhdOkCopN_x2EoQgMOPyEaLfJE8 |
| amplifiedmarketingservices.com | TXT | 3600 | txt:MS=ms13170074 |
| amplifiedmarketingservices.com | TXT | 3600 | txt:v=spf1 include:spf.protection.outlook.com -all |
|
Domain Name: AMPLIFIEDMARKETINGSERVICES.COM Registry Domain ID: 1830025998_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: https://www.godaddy.com Updated Date: 2018-10-06T11:58:24Z Creation Date: 2013-10-05T16:30:13Z Registrar Registration Expiration Date: 2023-10-05T16:30:13Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Registrant Street: DomainsByProxy.com Registrant Street: 2155 E Warner Rd Registrant City: Tempe Registrant State/Province: Arizona Registrant Postal Code: 85284 Registrant Country: US Registrant Phone: +1.4806242599 Registrant Phone Ext: Registrant Fax: +1.4806242598 Registrant Fax Ext: Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=AMPLIFIEDMARKETINGSERVICES.COM Registry Admin ID: Not Available From Registry Admin Name: Registration Private Admin Organization: Domains By Proxy, LLC Admin Street: DomainsByProxy.com Admin Street: 2155 E Warner Rd Admin City: Tempe Admin State/Province: Arizona Admin Postal Code: 85284 Admin Country: US Admin Phone: +1.4806242599 Admin Phone Ext: Admin Fax: +1.4806242598 Admin Fax Ext: Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=AMPLIFIEDMARKETINGSERVICES.COM Registry Tech ID: Not Available From Registry Tech Name: Registration Private Tech Organization: Domains By Proxy, LLC Tech Street: DomainsByProxy.com Tech Street: 2155 E Warner Rd Tech City: Tempe Tech State/Province: Arizona Tech Postal Code: 85284 Tech Country: US Tech Phone: +1.4806242599 Tech Phone Ext: Tech Fax: +1.4806242598 Tech Fax Ext: Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=AMPLIFIEDMARKETINGSERVICES.COM Name Server: NS65.DOMAINCONTROL.COM Name Server: NS66.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2022-10-13T05:07:36Z |
| Server IP | 198.185.159.145 |
| Server Location | United States of America |
| Service Provider | SQUARESPACE |
| Domains (TLD) | Status |
|---|---|
| amplifiedmarketingservices.net | Available |
| amplifiedmarketingservices.org | Already Registered |
| amplifiedmarketingservices.biz | Already Registered |
| amplifiedmarketingservices.io | Already Registered |
| amplifiedmarketingservices.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| qmplifiedmarketingservices.com | Available |
| wmplifiedmarketingservices.com | Available |
| zmplifiedmarketingservices.com | Available |
| xmplifiedmarketingservices.com | Available |
| anplifiedmarketingservices.com | Available |
| Ragni.com |
| Lovethreadingbar.com |
| Campuspromete.es |
| Asociar1.com |
| Nativeamericannutritionals.com |
| Brainwavestoys.com |
| Chairpartsonline.com |
| Asyncmanifesto.org |
| Petraseidel.com |
| Dcwsbz.com |